OAS2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82758-2-RR (same clone as 82758-2-PBS)

  IFN alpha treated A549 cells were subjected to SDS PAGE followed by western blot with 82758-2-RR (OAS2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82758-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 82758-2-RR (same clone as 82758-2-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 82758-2-RR (OAS2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82758-2-PBS in a different storage buffer formulation.

OAS2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82758-2-PBS

Clone No.242801F11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:2.7.7.84, 2'-5'-oligoadenylate synthase 2, 2-5A synthase 2, 242801F11, (2-5')oligo(A) synthase 2

---

Product Information

82758-2-PBS targets OAS2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6170

  Product name: Recombinant human OAS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 335-687 aa of BC049215

  Sequence: VLPAPLFTTPGHLLDKFIKEFLQPNKCFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSFDVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLKDLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVTQYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEAKEWLSSPCFKDGTGNPIPPWKVPVKVI

• Full Name: 2'-5'-oligoadenylate synthetase 2, 69/71kDa
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 66-71 kDa
• GenBank Accession Number: BC049215
• Gene Symbol: OAS2
• Gene ID (NCBI): 4939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29728
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS2, are IFN-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). OAS2 is also named as p69 OAS / p71 OAS. It has 3 isoforms(71/69/20 kDa) produced by alternative splicing. The OAS2 isozymes are 69-71 kDa and form dimers(PMID:17765707). Glycosylation is essential for its activity(PMID:9880569). Constitutive expression of the 69-kDa form of the OAS2 protein in human cells inhibited the replication of encephalomyocarditis virus (EMCV) but not that of VSV, Sendai virus, or reovirus(PMID:16501108).