OAS3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85392-2-RR (same clone as 85392-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85392-2-RR (OAS3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85392-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 85392-2-RR (same clone as 85392-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85392-2-RR (OAS3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85392-2-PBS in a different storage buffer formulation.

OAS3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85392-2-PBS

Clone No.242840E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

P/OKcl.4, EC:2.7.7.84, 2'-5'-oligoadenylate synthase 3, 2-5A synthase 3, 242840E2

---

Product Information

85392-2-PBS targets OAS3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17411

  Product name: Recombinant human OAS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC113746

  Sequence: MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQGLWKETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGC

• Full Name: 2'-5'-oligoadenylate synthetase 3, 100kDa
• Calculated Molecular Weight: 1087 aa, 121 kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: BC113746
• Gene Symbol: OAS3
• Gene ID (NCBI): 4940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y6K5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS3, are interferon-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). It is also named as p100 OAS and belongs to the 2-5A synthase family. OAS3 is involved in inhibition of cellular protein synthesis and in viral infection resistance.