OATL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OATL1 Polyclonal antibody, PBS Only (28597-1-PBS)

• 

  WB analysis using 28597-1-AP (same clone as 28597-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28597-1-AP (OATL1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28597-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 28597-1-AP (same clone as 28597-1-PBS)

  WB result of OATL1 antibody (28597-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-OATL1 transfected HEK-293 cells. This data was developed using the same antibody clone with 28597-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28597-1-AP (same clone as 28597-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28597-1-AP (OATL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28597-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

OATL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28597-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

TBC1D25, TBC1 domain family member 25, TBC1 domain family, member 25

---

Product Information

28597-1-PBS targets OATL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29470

  Product name: Recombinant human TBC1D25 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 32-299 aa of BC101817

  Sequence: EREVVRVRVKKCESFLPPEFRSFAVDPQITSLDVLQHILIRAFDLSGKKNFGISYLGRDRLGQEVYLSLLSDWDLSTAFATASKPYLQLRVDIRPSEDSPLLEDWDIISPKDVIGSDVLLAEKRSSLTTAALPFTQSILTQVGRTLSKVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRYLLNVYPDGLTGRERMDYMKRKSREYEQLKSEWAQRANPEDLEFIRSTVLKDVLRTDRAH

• Full Name: TBC1 domain family, member 25
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC101817
• Gene Symbol: TBC1D25
• Gene ID (NCBI): 4943
• RRID: AB_3669665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3MII6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OATL1, also known as TBC1D25, is a protein with a TBC domain and functions as a Rab GTPase activating protein. It is involved in the fusion of autophagosomes with endosomes and lysosomes. OATL1 is recruited to isolation membranes and autophagosomes through direct interaction with Atg8 homologues and is involved in the fusion between autophagosomes and lysosomes through its GAP activity.