OATP14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OATP14 Polyclonal antibody (17163-1-AP)

OATP14 Polyclonal Antibody for WB, IP, ELISA

Cat No. 17163-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

OAT RP 5, OATP 14, OATP F, OATP1, OATP14, OATP1C1, OATPF, OATPRP5, Organic anion transporter F, SLC21A14, SLCO1C1

• 

  WB analysis of PC-3 using 17163-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 17163-1-AP (OATP14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 17163-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17163-1-AP (OATP14 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 17163-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17163-1-AP (OATP14 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 17163-1-AP

  IP result of anti-OATP14 (IP:17163-1-AP, 4ug; Detection:17163-1-AP 1:800) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for OATP14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-3 cells, mouse brain tissue, mouse kidney tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17163-1-AP targets OATP14 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10573

  Product name: Recombinant human OATP14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 290-391 aa of BC022461

  Sequence: VPFWYLPKSLPRSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLCTSTVQFNSLFGMVTYKPKYIEQQYGQSSSRA

• Full Name: solute carrier organic anion transporter family, member 1C1
• Calculated Molecular Weight: 712 aa, 79 kDa
• Observed Molecular Weight: 62-70 kDa
• GenBank Accession Number: BC022461
• Gene Symbol: SLCO1C1
• Gene ID (NCBI): 53919
• RRID: AB_2189706
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYB5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The OATP14 Polyclonal antibody (Cat# 17163-1-AP) has 3 total citations. These appear in Thyroid, Toxicology, and Toxicological Sciences. The associated research fields include thyroid hormone signaling and neurotoxicity (diabetes-associated cognitive dysfunction, glioma hypothyroidism) and hepatotoxicity/metabolic toxicity evaluation of nanomaterials. All citations used the antibody for Western blot in human or mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Thyroid; Increased thyroid hormone action alleviates hippocampal damage by down-regulating neuronal type-Ⅰ interferon signaling/necroptosis in diabetes-associated cognitive dysfunction; Authors - Ling Tian
human	WB	Toxicology; BDE209-promoted Dio2 degradation in H4 glioma cells through the autophagy pathway, resulting in hypothyroidism and leading to neurotoxicity; Authors - Min Liu
mouse	WB	Toxicol Sci; Hepatic, metabolic and toxicity evaluation of repeated oral administration of SnS2 nanoflowers in mice.; Authors - Disi Bai