OATP1A2 Polyclonal antibody

• 

  WB analysis using 31626-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31626-1-AP (SLCO1A2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

OATP1A2 Polyclonal Antibody for WB, ELISA

Cat No. 31626-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SLCO1A2, OATP1, OATP

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human heart tissue, mouse heart tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31626-1-AP targets OATP1A2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34497

  Product name: Recombinant human SLCO1A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 406-513 aa of NM_021094

  Sequence: FLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYF

• Full Name: solute carrier organic anion transporter family, member 1A2
• Calculated Molecular Weight: 670 aa, 74 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_021094
• Gene Symbol: SLCO1A2
• Gene ID (NCBI): 6579
• RRID: AB_3670054
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P46721
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLCO1A2 also known as OATP1A2, is a member of the SLC21A family of solute carriers. SLCO1A2 encodes a sodium-independent transporter that mediates cellular uptake of organic ions in the liver(PMID: 19129463). It has been reported that SLCO1A2 detected a nonglycosylated form around 59kDa and 70-75 kDa glycosylated form(PMID: 15632119).