Use Able AI chat for product recommendations

OCIAD1 Polyclonal antibody

OCIAD1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

TPA018, Ovarian cancer immunoreactive antigen domain containing 1, OCIA domain-containing protein 1, OCIA domain containing 1, OCIA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for OCIAD1 in ?

Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, human placenta tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman liver cancer tissue, human kidney tissue, human pancreas cancer tissue, human thyroid cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16634-1-AP targets OCIAD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9977

Product name: Recombinant human OCIAD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-245 aa of BC003409

Sequence: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE

Predict reactive species
Full Name OCIA domain containing 1
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 29-35 kDa
GenBank Accession NumberBC003409
Gene Symbol OCIAD1
Gene ID (NCBI) 54940
RRIDAB_2156297
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NX40
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OCIAD1 was first identified by immunoscreening of an ovarian carcinoma cDNA expression library with ascites fluid from ovarian cancer patients (PMID: 11162530). OCIAD1 has been reported as a key player in ovarian cancer cell adhesion, as well as a key player in generating ovarian cancer recurrence (PMID: 18328549; 20515946). In addition to its roles in cancer, OCIAD1 participates in maintaining stem cell potency by regulating the Jak/STAT pathway (PMID: 23972987). Several alternatively spliced forms of OCIAD1 gene have been identified. The longest form (1.4 kb) is predicted to encode for a 27.6 kDa protein of 245 amino acids. This antibody detects OCIAD1 with an apparent molecular weight of ~35 kDa as has been demonstrated by several researches (PMID: 27345969; 27345976).

Protocols

Product Specific Protocols
IF protocol for OCIAD1 antibody 16634-1-APDownload protocol
IHC protocol for OCIAD1 antibody 16634-1-APDownload protocol
IP protocol for OCIAD1 antibody 16634-1-APDownload protocol
WB protocol for OCIAD1 antibody 16634-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The OCIAD1 Polyclonal antibody (Cat# 16634-1-AP) has 2 total citations. These appear in PLoS One and Pathol Int. The cited research covers two fields: hepatitis C virus biology (OCIAD1 as a host mitochondrial substrate of HCV NS3-4A protease) and ovarian mucinous tumor progression (increased OCIAD2 expression during stepwise tumor progression). Applications used include WB, IF, and IHC in human samples.

SpeciesApplicationTitle
humanWB,IF

PLoS One

OCIAD1 is a host mitochondrial substrate of the hepatitis C virus NS3-4A protease.

Authors - Huong T L Tran
humanIHC

Pathol Int

Increased expression of OCIA domain containing 2 during stepwise progression of ovarian mucinous tumor.

Authors - Nagata Chigusa C
Loading...
||
New chat

Able™

正在加载,请稍候...