OCIAD2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OCIAD2 Polyclonal antibody, PBS Only (13437-1-PBS)

• 

  WB analysis using 13437-1-AP (same clone as 13437-1-PBS)

  U-251 cells were subjected to SDS PAGE followed by western blot with 13437-1-AP (OCIAD2 antibody) at dilution of 1:1000 and incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13437-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13437-1-AP (same clone as 13437-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13437-1-AP (OCIAD2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13437-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13437-1-AP (same clone as 13437-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13437-1-AP (OCIAD2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13437-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 13437-1-AP (same clone as 13437-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 13437-1-AP (OCIAD2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13437-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 13437-1-AP (same clone as 13437-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using OCIAD2 antibody (13437-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13437-1-PBS in a different storage buffer formulation.

OCIAD2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13437-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Ovarian carcinoma immunoreactive antigen-like protein, OCIA domain-containing protein 2, OCIA domain containing 2

---

Product Information

13437-1-PBS targets OCIAD2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4243

  Product name: Recombinant human OCIAD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC032808

  Sequence: MASASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAANSRFGSLPKVARTASLPVRNAK

• Full Name: OCIA domain containing 2
• Calculated Molecular Weight: 99 aa, 11 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC032808
• Gene Symbol: OCIAD2
• Gene ID (NCBI): 132299
• RRID: AB_3085414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q56VL3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.