oncomodulin Polyclonal antibody

• 

  IHC staining of human placenta using 21650-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21650-1-AP (OCM antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 21650-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21650-1-AP (OCM antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

oncomodulin Polyclonal Antibody for IHC, ELISA

Cat No. 21650-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

OCM, OCM1, OCMN, OM, ONCM, oncomodulin, Oncomodulin 1, Parvalbumin beta

---

Tested Applications

• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21650-1-AP targets oncomodulin in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16358

  Product name: Recombinant human OCM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-109 aa of BC113706

  Sequence: MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS

• Full Name: oncomodulin
• Calculated Molecular Weight: 109 aa, 12 kDa
• GenBank Accession Number: BC113706
• Gene Symbol: Oncomodulin
• Gene ID (NCBI): 654231
• RRID: AB_3669371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0CE72
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Oncomodulin (OCM) is a small EF-hand Ca2+-binding protein (CaBP) of approximately 12 kDa belonging to the parvalbumin family. Oncomodulin (OCM) consists of two active Ca2+-specific domains of the EF-hand type ("helix-loop-helix" motif), covered by an EF-hand domain with inactive EF-hand loop, which contains a highly conservative cysteine with unknown function.