ODC1 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HeLa using 83108-1-RR (same clone as 83108-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ODC1 antibody (83108-1-RR, Clone: 230339H4 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 83108-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 83108-1-RR (same clone as 83108-1-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug Anti-Human ODC1 (83108-1-RR, Clone:230339H4) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83108-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83108-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83108-1-RR against Human ODC1 were performed. The affinity constant is 172 nM.

ODC1 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83108-1-PBS

Clone No.230339H4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

230339H4, EC:4.1.1.17, ODC

---

Product Information

83108-1-PBS targets ODC1 in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29751

  Product name: Recombinant human ODC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-188 aa of BC025296

  Sequence: MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELN

• Full Name: ornithine decarboxylase 1
• Calculated Molecular Weight: 461 aa, 51 kDa
• GenBank Accession Number: BC025296
• Gene Symbol: ODC1
• Gene ID (NCBI): 4953
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11926
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.