Teneurin 1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Teneurin 1 Polyclonal antibody (21696-1-AP)

Teneurin 1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21696-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ODZ1, Protein Odd Oz/ten-m homolog 1, Ten 1, TEN M1, Ten-1

• 

  WB analysis using 21696-1-AP

  Various lysates were subjected to SDS page followed by western blot with 21696-1-AP (ODZ1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of H69/H146 cells using 21696-1-AP

  WB result of anti-ODZ1 (21696-1-AP) with two cell lines by Dr. Petrini, Iacopo.

• 

  IHC staining of human brain using 21696-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 21696-1-AP (ODZ1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 21696-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 21696-1-AP (ODZ1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 21696-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21696-1-AP (Teneurin 1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 21696-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21696-1-AP (Teneurin 1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, H69/H146 cells, rat brain tissue
• Positive IHC detected in: human brain tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21696-1-AP targets Teneurin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16289

  Product name: Recombinant human ODZ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-280 aa of BC140783

  Sequence: MEQTDCKPYQPLPKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHALRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDVQSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQDSVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNY

• Full Name: odz, odd Oz/ten-m homolog 1(Drosophila)
• Calculated Molecular Weight: 2732 aa, 306 kDa
• Observed Molecular Weight: 305 kDa
• GenBank Accession Number: BC140783
• Gene Symbol: Teneurin 1
• Gene ID (NCBI): 10178
• RRID: AB_10858625
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKZ4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ODZ1 (also known as teneurin-1, TENM1), which plays a key role in central nervous system ontogenesis. ODZ1 is upregulated in Glioblastoma cells through a Stat3-mediated pathway activated by IL-6, which is released by tumor-associated monocytes. In addition, a hypoxic microenvironment regulates GBM tumor cell migration in part by inducing ODZ1 through hypomethylation of a CpG island in the ODZ1 promoter.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; The Cancer Cell Line Encyclopedia enables predictive modelling of anticancer drug sensitivity.; Authors - Barretina Jordi J
human	WB	Genet Res (Camb); Impact of Extracellular Matrix-Related Genes on the Tumor Microenvironment and Prognostic Indicators in Esophageal Cancer: A Comprehensive Analytical Study; Authors - Yinghong Wu