OGFOD2 Polyclonal antibody

• 

  WB analysis using 21590-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21590-1-AP (OGFOD2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 21590-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 21590-1-AP (OGFOD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 21590-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21590-1-AP (OGFOD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 21590-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21590-1-AP (OGFOD2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 21590-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21590-1-AP (OGFOD2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 21590-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21590-1-AP (OGFOD2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21590-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21590-1-AP (OGFOD2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

OGFOD2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21590-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

OGFOD2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human testis tissue, human skeletal muscle tissue, mouse liver tissue, rat liver tissue
• Positive IHC detected in: mouse brain tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21590-1-AP targets OGFOD2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16164

  Product name: Recombinant human OGFOD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC098293

  Sequence: FTAPFCQALLEELEHFEQSDMPKGRPNTMNNYGVLLHELGLDEPLMTPLRERFLQPLMALLYPDCGGGRLDSHRAFVVKYAPGQDLELGCHYDNAELTLNVALGKVFTGGALYFGGLFQAPTALTEPLEVEHVVGQGVLHRGGQLHGARPLGTGERWNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCALT

• Full Name: 2-oxoglutarate and iron-dependent oxygenase domain containing 2
• Calculated Molecular Weight: 350 aa, 39 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC098293
• Gene Symbol: OGFOD2
• Gene ID (NCBI): 79676
• RRID: AB_10734327
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6N063
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OGFOD2 belongs to the OGFOD2 family. OGFOD2 has 4 isoforms with the molecular mass of 15, 20, 32 and 39 kDa.