OIP5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85757-5-RR (same clone as 85757-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85757-5-RR (OIP5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85757-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85757-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85757-5-RR against Human OIP5 were performed. The affinity constant is below 1 pM.

OIP5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85757-5-PBS

Clone No.250073A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CT86, LINT 25, LINT25, MIS18B, OIP 5

---

Product Information

85757-5-PBS targets OIP5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2790

  Product name: Recombinant human OIP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC015050

  Sequence: MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN

• Full Name: Opa interacting protein 5
• Calculated Molecular Weight: 229 aa, 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC015050
• Gene Symbol: OIP5
• Gene ID (NCBI): 11339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43482
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OIP5 is also known as Mis18β. Vertebrates possess two Mis18 paralogs, Mis18α and Mis18β. Mis18 has been previously shown to affect histone modifications and the methylation status of underlying chromatin . Eliminating histone methylation within the alpha satellite DNA repeats of a human artificial chromosome alters the recruitment of HJURP .The Mis18core complex was originally characterized as an oligomer with a proposed 2:2 stoichiometry of Mis18α and Mis18β, but additional work demonstrated a 4:2 Mis18α:Mis18β hexamer. (PMID: 31492860, PMID: 26942680)