OLFM3 Polyclonal antibody

• 

  WB analysis of PC-3 using 12596-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12596-1-AP (OLFM3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A2780 using 12596-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 12596-1-AP (OLFM3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 12596-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 12596-1-AP (OLFM3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 12596-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12596-1-AP (OLFM3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 12596-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12596-1-AP (OLFM3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 12596-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12596-1-AP (OLFM3 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 12596-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12596-1-AP (OLFM3 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 12596-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using OLFM3 antibody (12596-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

OLFM3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12596-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Olfactomedin 3, NOE3, Noelin 3, NOELIN3, Noelin-3

---

Tested Applications

• Positive WB detected in: PC-3 cells, A2780 cells, human liver tissue, mouse liver tissue, NIH/3T3 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

12596-1-AP targets OLFM3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3207

  Product name: Recombinant human OLFM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 159-458 aa of BC022531

  Sequence: NLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPVTVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDMGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALCAWNNGHQVLFNVTLFHIIKTEDDT

• Full Name: olfactomedin 3
• Calculated Molecular Weight: 458 aa, 53 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC022531
• Gene Symbol: OLFM3
• Gene ID (NCBI): 118427
• RRID: AB_2157228
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PB7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OLFM3, also known as Noelin-3, belongs to a larger family of proteins containing the olfactomedin domain. OLFM3, which is most closely related to OLFM2, is expressed in the retinal ganglion and inner nuclear layers of the adult rat retina (PMID: 12019210).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Front Cell Dev Biol; Olfactomedin-3 Enhances Seizure Activity by Interacting With AMPA Receptors in Epilepsy Models.; Authors - Shirong Tang