OLIG2 Polyclonal antibody, PBS Only

OLIG2 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 25754-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

OLIG 2, Class E basic helix-loop-helix protein 19, Class B basic helix-loop-helix protein 1, bHLHe19, bHLHb1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

25754-1-PBS targets OLIG2 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22642

Product name: Recombinant human OLIG2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-105 aa of BC047511

Sequence: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPE

Predict reactive species
Full Name oligodendrocyte lineage transcription factor 2
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC047511
Gene Symbol OLIG2
Gene ID (NCBI) 10215
RRIDAB_2880226
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13516
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The oligodendrocyte lineage-specific basic helix-loop-helix (OLIG) family of transcription factors include OLIG1-OLIG3, which differ in tissue expression. OLIG1 and OLIG2 are specifically expressed in nervous tissue as gene regulators of oligodendrogenesis. OLIG1 and OLIG2 interact with the Nkx-2.2 homeodomain protein, which is responsible for directing ventral neuronal patterning in response to graded Sonic hedgehog signaling in the embryonic neural tube. These interactions between OLIG proteins and Nkx-2.2 appear to promote the formation of alternate cell types by inhibiting V3 interneuron development. OLIG1 and OLIG2 are abundantly expressed in oligodendroglioma and nearly absent in astrocytomas. Therefore, OLIG proteins are candidates for molecular markers of human glial brain tumors, which are the most common primary malignancies of the human brain.

Loading...
||
New chat Able
正在加载,请稍候...