OLR1/LOX1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OLR1/LOX1 Polyclonal antibody (32685-1-AP)

• 

  WB analysis using 32685-1-AP

  Non-treated mouse lung and PNGF treated mouse lung tissue were subjected to SDS PAGE followed by western blot with 32685-1-AP (OLR1/LOX1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse placenta using 32685-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 32685-1-AP (OLR1/LOX1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse placenta using 32685-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 32685-1-AP (OLR1/LOX1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

OLR1/LOX1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32685-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

Lectin-like oxidized LDL receptor 1, Lectin-like oxLDL receptor 1, Lectin-type oxidized LDL receptor 1, Lox1, LOX-1

---

Tested Applications

• Positive WB detected in: mouse lung tissue, PNGF treated mouse lung tissue
• Positive IHC detected in: mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32685-1-AP targets OLR1/LOX1 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2473

  Product name: Recombinant Mouse OLR1/LOX1 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 60-363 aa of NM_138648.2

  Sequence: RQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

• Full Name: oxidized low density lipoprotein (lectin-like) receptor 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 65-70 kDa, 37 kDa
• GenBank Accession Number: NM_138648.2
• Gene Symbol: Olr1
• Gene ID (NCBI): 108078
• RRID: AB_3742705
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9EQ09
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OLR1/LOX-1 acts as a receptor, in the form of homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). OLR1/LOX1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). Mouse OLR1/LOX1 is type II transmembrane protein containing 363 amino acids and has a cytoplasmic N-terminus and an extracellular C-terminus comprising the neck domain and the ligand-binding domain (CTLD) (PMID: 9588202). The molecular mass of mouse OLR1/LOX-1 at 65-70 kDa may be a fully glycosylated form, which is reduced to approximately 37 kDa after treatment with the deglycosylase PNGase.