Anti-Human OLR1/LOX1 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human OLR1/LOX1 Rabbit Recombinant Antibody, PBS Only (98524-3-PBS)

OLR1/LOX1 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98524-3-PBS

Clone No.250525B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

OLR1, CLEC8A, C-type lectin domain family 8 member A, hLOX 1, hLOX1

• 

  FC experiment of human PBMCs using 98524-3-RR (same clone as 98524-3-PBS)

  1x10^6 untreated or GM-CSF-treated human PBMCs were surface stained with 0.25 ug Anti-Human OLR1/LOX1 Rabbit RecAb (98524-3-RR, Clone: 250525B12) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human CD14. Cells were not fixed. Monocytes were gated. This data was developed using the same antibody clone with 98524-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using 98524-3-RR (same clone as 98524-3-PBS)

  1x10^6 GM-CSF-treated human PBMCs were surface stained with 0.25 ug Anti-Human OLR1/LOX1 Rabbit RecAb (98524-3-RR, Clone: 250525B12) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated human PBMCs were surface stained with 0.25 ug Anti-Human OLR1/LOX1 Rabbit RecAb (98524-3-RR, Clone: 250525B12) (black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. Monocytes were gated. This data was developed using the same antibody clone with 98524-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

98524-3-PBS targets OLR1/LOX1 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2911

  Product name: Recombinant Human OLR1/LOX1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 61-273 aa of NM_002543.3

  Sequence: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

• Full Name: oxidized low density lipoprotein (lectin-like) receptor 1
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: NM_002543.3
• Gene Symbol: OLR1
• Gene ID (NCBI): 4973
• RRID: AB_3746152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78380-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OLR1/LOX-1 acts as a receptor, in the form of homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). ORL1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). OLR1 is a protein containing 273 amino acids with a calculated molecular mass of 31 kDa but an apparent molecular mass of 50 kDa, which may result from the glycosylation of four potential N-linked glycosylation sites located at the C-terminal domain (PMID: 9052782).