OMA1 Monoclonal antibody, PBS Only (Detector)

OMA1 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 67449-1-PBS
Clone No.1H4D12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Overlapping with the m-AAA protease 1 homolog, MPRP-1, MPRP1, Metalloprotease-related protein 1, EC:3.4.24.-

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67449-1-PBS targets OMA1 as part of a matched antibody pair:

MP50571-3: 66572-1-PBS capture and 67449-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11201

Product name: Recombinant human OMA1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 361-524 aa of BC012915

Sequence: ICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS

Predict reactive species
Full Name OMA1 homolog, zinc metallopeptidase (S. cerevisiae)
Calculated Molecular Weight 524 aa, 60 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC012915
Gene Symbol OMA1
Gene ID (NCBI) 115209
RRIDAB_2882683
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ96E52
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

OMA1(Overlapping with the m-AAA protease 1 homolog) is also named as MPRP1(Metalloprotease-related protein 1) and belongs to the peptidase M48 family.It is a zinc metalloprotease that spans the inner mitochondrial membrane with a number of predicted membrane spanning domains and the 60 kDa form of OMA1 rapidly accumulated concomitantly with the cleavage of all OPA1 variants,and the 40 kDa form of OMA1 may be the inactive form, with the 60 kDa form being the active enzyme(PMID:20334834)

Loading...
||
New chat

Able

正在加载,请稍候...