OMG Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86584-1-RR (same clone as 86584-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86584-1-RR (OMGP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86584-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 86584-1-RR (same clone as 86584-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 86584-1-RR (OMGP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86584-1-PBS in a different storage buffer formulation.

OMG Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86584-1-PBS

Clone No.251402D4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Oligodendrocyte-myelin glycoprotein, OMGP

---

Product Information

86584-1-PBS targets OMG in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5825

  Product name: Recombinant human OMGP protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 25-417 aa of NM_002544.5

  Sequence: ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPS

• Full Name: oligodendrocyte myelin glycoprotein
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_002544.5
• Gene Symbol: OMG
• Gene ID (NCBI): 4974
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23515
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OMG (oligodendrocyte myelin glycoprotein), also known as OMGP. It is expected to be located in cell membrane, the protein is mainly expressed in the central nervous system in both neurons and oligodendrocytes. The calculated molecular weight of OMG is 50 kDa, and o-glycosylated in its Ser/Thr-rich repeat domain. It is also a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system. Axonal regeneration in the adult spinal cord is thought to be at least partially blocked after injury by inhibitory myelin components, including Nogo, myelin associated glycoprotein (MAG) and oligodendrocyte-myelin glycoprotein (OMGP).