OMP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OMP Polyclonal antibody (18185-1-AP)

OMP Polyclonal Antibody for WB, ELISA

Cat No. 18185-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Olfactory neuronal-specific protein

• 

  WB analysis of mouse brain using 18185-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18185-1-AP (OMP Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for OMP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18185-1-AP targets OMP in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12899

  Product name: Recombinant human OMP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-159 aa of BC069365

  Sequence: MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVV

• Full Name: olfactory marker protein
• Calculated Molecular Weight: 163 aa, 19 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC069365
• Gene Symbol: OMP
• Gene ID (NCBI): 4975
• RRID: AB_2878514
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47874
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The OMP polyclonal antibody (Cat# 18185-1-AP) has 1 total citation. It appears in International Immunology (2021), in a study investigating how Helicobacter urease suppresses cytotoxic CD8+ T cell responses through Myh9-dependent induction of PD-L1. The associated research field is immunology, specifically host-pathogen interactions and immune evasion mechanisms.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Int Immunol; Helicobacter urease suppresses cytotoxic CD8 + T cell responses through activating Myh9-dependent induction of PD-L1.; Authors - Jian Wu