Filter: AllIP

IP experiment of mouse retina using 33320-1-AP (same clone as 33320-1-PBS)
IP result of anti-OPN1LW (IP:33320-1-AP, 4ug; Detection:33320-1-AP 1:500) with mouse retina tissue lysate 720 ug. This data was developed using the same antibody clone with 33320-1-PBS in a different storage buffer formulation.
IP experiment of rat retina using 33320-1-AP (same clone as 33320-1-PBS)
IP result of anti-OPN1LW (IP:33320-1-AP, 4ug; Detection:33320-1-AP 1:500) with rat retina tissue lysate 400 ug. This data was developed using the same antibody clone with 33320-1-PBS in a different storage buffer formulation.

OPN1LW Polyclonal antibody, PBS Only

Name: OPN1LW Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 33320-1-PBS

OPN1LW Polyclonal Antibody for IP, Indirect ELISA

Cat No. 33320-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IP, Indirect ELISA

Synonyms

Long-wave-sensitive opsin 1, RCP, Red cone photoreceptor pigment, Red-sensitive opsin, ROP

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

33320-1-PBS targets OPN1LW in IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag37894 Product name: Recombinant human OPN1LW protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC156643 Sequence: MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV Predict reactive species
Full Name	opsin 1 (cone pigments), long-wave-sensitive
Observed Molecular Weight	40 kDa
GenBank Accession Number	BC156643
Gene Symbol	OPN1LW
Gene ID (NCBI)	5956
RRID	AB_3742939
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	P04000
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™