Opticin Polyclonal antibody

• 

  WB analysis of mouse brain using 17897-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17897-1-AP (Opticin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse cerebellum using 17897-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 17897-1-AP (Opticin antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

Opticin Polyclonal Antibody for WB, ELISA

Cat No. 17897-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

OPTC, OPT, Oculoglycan

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17897-1-AP targets Opticin in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12257

  Product name: Recombinant human OPTC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-332 aa of BC074943

  Sequence: MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQPNHGLPTCLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLKRIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT

• Full Name: opticin
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC074943
• Gene Symbol: Opticin
• Gene ID (NCBI): 26254
• RRID: AB_2251719
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBM4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.