Product Information
26954-1-PBS targets OR2H1 in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25268 Product name: Recombinant human OR2H1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 128-170 aa of BC048991 Sequence: LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ Predict reactive species |
| Full Name | olfactory receptor, family 2, subfamily H, member 1 |
| Calculated Molecular Weight | 35 kDa |
| GenBank Accession Number | BC048991 |
| Gene Symbol | OR2H1 |
| Gene ID (NCBI) | 26716 |
| RRID | AB_3669577 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9GZK4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Olfactory receptors (ORs) are part of the G protein-coupled receptor (GPCR) superfamily. Olfactory receptors interact with odor molecules in the nose, initiating neuronal responses that lead to olfactory perception. Olfactory receptor, family 2, subfamily H, member 1(OR2H1) is widely expressed in solid epithelial tumors but not in other normal human tissues except testis (PMID: 35499393).



