OR2H1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OR2H1 Polyclonal antibody, PBS Only (26954-1-PBS)

• 

  IHC staining of human lung cancer using 26954-1-AP (same clone as 26954-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26954-1-AP (OR2H1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26954-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 26954-1-AP (same clone as 26954-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26954-1-AP (OR2H1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26954-1-PBS in a different storage buffer formulation.

OR2H1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 26954-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

26954-1-PBS targets OR2H1 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25268

  Product name: Recombinant human OR2H1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 128-170 aa of BC048991

  Sequence: LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ

• Full Name: olfactory receptor, family 2, subfamily H, member 1
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: BC048991
• Gene Symbol: OR2H1
• Gene ID (NCBI): 26716
• RRID: AB_3669577
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZK4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Olfactory receptors (ORs) are part of the G protein-coupled receptor (GPCR) superfamily. Olfactory receptors interact with odor molecules in the nose, initiating neuronal responses that lead to olfactory perception. Olfactory receptor, family 2, subfamily H, member 1(OR2H1) is widely expressed in solid epithelial tumors but not in other normal human tissues except testis (PMID: 35499393).