Tested Applications
| Positive WB detected in | MDA-MB-453s cells, MCF-7 cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28411-1-AP targets ORAI1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29234 Product name: Recombinant human ORAI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 200-275 aa of BC015369 Sequence: LPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIASTTIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNE Predict reactive species |
| Full Name | ORAI calcium release-activated calcium modulator 1 |
| Calculated Molecular Weight | 301 aa, 33 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC015369 |
| Gene Symbol | ORAI1 |
| Gene ID (NCBI) | 84876 |
| RRID | AB_2918160 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96D31 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Store-operated calcium channels (SOCs) play essential functions in various physiological processes. ORAI1 is a complex glycosylated protein, it exists in several molecular weight forms: a theoretical molecular weight of 32.7 kDa of the unmodified protein and two major glycosylated proteins of ~43 kDa and ~50 kDa (PMID: 22318387). Human patients with a severe combinaed immunodeficiency (SCID) syndrome possess point mutations in Orai1 gene.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ORAI1 antibody 28411-1-AP | Download protocol |
| WB protocol for ORAI1 antibody 28411-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-ORAI1 antibody (Cat# 28411-1-AP) has 14 total citations published in journals including Phytomedicine, Journal of Orthopaedic Translation, Biomaterials Research, Cell & Molecular Life Sciences, Life Sciences, Frontiers in Pharmacology, Journal of Molecular Medicine, Journal of Dairy Science, Journal of Animal Science, Frontiers in Oncology, Animals, Journal of Traditional Chinese Medicine, and Experimental Lung Research. Research fields span calcium signaling, oncology, immunology, bone biology, vascular physiology, respiratory disease, and animal science.
| Species | Application | Title |
|---|---|---|
Phytomedicine β-mangostin triggers ER stress-mediated mitochondrial dysfunction to induce apoptosis in colorectal cancer. | ||
J Orthop Translat Tibial cortex transverse transport regulates Orai1/STIM1-mediated NO release and improve the migration and proliferation of vessels via increasing osteopontin expression | ||
Biomater Res Mesenchymal Stem Cell-Derived Exosomes Inhibit Stim1-Orai1 Signaling and Calcium Overload-Induced Mitochondrial Damage of Follicular Helper T Cells in Lupus | ||
Cell Mol Life Sci Eldecalcitol ameliorates diabetic osteoporosis and glucolipid metabolic disorder by promoting Treg cell differentiation through SOCE | ||
Life Sci The role of STIM1/ORAI1 channel in the analgesic effect of grain-sized moxibustion on inflammatory pain mice model. | ||
Front Pharmacol Trifolin inhibits the calcium-driven contraction pathway in vascular smooth muscle |
Reviews
What customers say
One user (R. Zimny) reviewed this product in September 2024, rating it 3 out of 5 stars for Western Blot. The reviewer reported that results were spotty and some non-specific binding occurred. Overall, the feedback suggests the antibody may require optimization of dilution or blocking conditions to improve specificity and signal consistency.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
R. (Verified Customer) (09-16-2024) | Results were spotty. Some non-specific binding occurred.
|
