ORC3L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ORC3L Polyclonal antibody, PBS Only (32429-1-PBS)

• 

  WB analysis using 32429-1-AP (same clone as 32429-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32429-1-AP (ORC3L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32429-1-PBS in a different storage buffer formulation.

ORC3L Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32429-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

LATHEO, ORC3, Origin recognition complex subunit 3, Origin recognition complex subunit Latheo

---

Product Information

32429-1-PBS targets ORC3L in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37481

  Product name: Recombinant human ORC3L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-207 aa of NM_012381.3

  Sequence: KPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTS

• Full Name: origin recognition complex, subunit 3-like (yeast)
• Calculated Molecular Weight: 66 kDa, 82 kDa
• Observed Molecular Weight: 66 kDa, 82 kDa
• GenBank Accession Number: NM_012381.3
• Gene Symbol: ORC3L
• Gene ID (NCBI): 23595
• RRID: AB_3742607
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UBD5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ORC3L, also known as Origin Recognition Complex Subunit 3-like, is a human gene that encodes a protein which is a subunit of the Origin Recognition Complex (ORC). The ORC is a highly conserved six-subunit protein complex that is essential for the initiation of DNA replication in eukaryotic cells. Studies in yeast have shown that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins.