OS9 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse testis using 82932-2-RR (same clone as 82932-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 82932-2-RR (OS9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82932-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 82932-2-RR (same clone as 82932-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 82932-2-RR (OS9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82932-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 82932-2-RR (same clone as 82932-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using OS9 antibody (82932-2-RR, Clone: 230149C6 ) at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 82932-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 82932-2-RR (same clone as 82932-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug OS9 Recombinant antibody (82932-2-RR, Clone:230149C6) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 82932-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82932-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82932-2-RR against Human OS9 were performed. The affinity constant is below 1 pM.

OS9 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 82932-2-PBS

Clone No.230149C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

230149C6, Amplified in osteosarcoma 9, Protein OS-9

---

Product Information

82932-2-PBS targets OS9 in IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0106

  Product name: Recombinant human OS9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-435 aa of BC000532

  Sequence: GRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDEDEDEDEDEDERQLLGE

• Full Name: osteosarcoma amplified 9, endoplasmic reticulum associated protein
• Calculated Molecular Weight: 76 kDa
• GenBank Accession Number: BC000532
• Gene Symbol: OS9
• Gene ID (NCBI): 10956
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13438
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OS-9 is a ubiquitously expressed ensoplasmic reticulum (ER)-associated protein originally identified as being amplified in certain osteosarcomas. It functions in ER quality control and ER-associated degradation (ERAD). There are three isoforms of this protein: OS-9.1, OS-9.2 and OS-9.3. The longest isoform, OS-9.1, contains 667 aa, OS-9.2 lacks aa 535-589, whereas OS-9.3 lacks aa 456-470 and 535-589. OS-9.1 and OS-9.2 are N-glycosylated, ubiquitously expressed in human tissues, and amplified in tumors.