KD/KO Validated

OSBPL3 Polyclonal antibody

OSBPL3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12417-1-AP

Publications (4)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA0704, ORP 3, ORP3, ORP-3, OSBP related protein 3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 12417-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 12417-1-AP (OSBPL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HCT 116 using 12417-1-AP
WB result of OSBPL3 antibody (12417-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-OSBPL3 transfected HCT 116 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 12417-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 12417-1-AP (OSBPL3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12417-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 Antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12417-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 Antibody) at dilution of 1:50 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12417-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12417-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 12417-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 12417-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse bladder using 12417-1-AP
Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat bladder using 12417-1-AP
Immunohistochemical analysis of paraffin-embedded rat bladder tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 12417-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for OSBPL3 in ?

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HCT 116 cells, K-562 cells, HeLa cells
Positive IHC detected in	human colon cancer tissue, rat bladder tissue, human ovary cancer tissue, mouse kidney tissue, rat kidney tissue, mouse bladder tissue, human colon cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12417-1-AP targets OSBPL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3044 Product name: Recombinant human OSBPL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC017731 Sequence: MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSA Predict reactive species
Full Name	oxysterol binding protein-like 3
Calculated Molecular Weight	887 aa, 101 kDa
Observed Molecular Weight	95-110 kDa
GenBank Accession Number	BC017731
Gene Symbol	OSBPL3
Gene ID (NCBI)	26031
RRID	AB_2156103
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H4L5
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OSBPL3 (ORP3) is an oxysterol-binding protein-related lipid transfer protein located at ER-plasma membrane contact sites. Its canonical isoform contains 887 amino acids with a theoretical molecular weight of 101.2 kDa. Western blot routinely detects a doublet around 103 kDa and 110 kDa, mainly caused by differential phosphorylation rather than splicing variants. It interacts with R-Ras and VAPA to modulate PI4P transport, actin cytoskeleton dynamics and cell adhesion. Aberrant OSBPL3 expression drives proliferation and metastasis in multiple cancers, acting as a prognostic biomarker and potential therapeutic target. (PMID: 32041906, 34584127)

Protocols

Product Specific Protocols
IHC protocol for OSBPL3 antibody 12417-1-AP	Download protocol
WB protocol for OSBPL3 antibody 12417-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The OSBPL3 Polyclonal antibody (Cat# 12417-1-AP) has 4 citations published in Translational Oncology, Biosci Reports (×2), and BMC Cancer. The research fields span lung adenocarcinoma metastasis and glycolysis regulation, colorectal cancer hub gene identification via WGCNA, and OSBPL family gene expression and immune infiltration in liver cancer. All citations used human samples with WB and/or IHC applications.

Species	Application	Title
human	WB,IHC	Transl Oncol OSBPL3 promotes LUAD metastasis and glycolysis through transcriptional upregulation of PLAU via NFE2L2. Authors - Qingqiong Zhang KD Validated View Article
human	IHC	Biosci Rep Identification of hub genes in colorectal cancer based on weighted gene co-expression network analysis and clinical data from The Cancer Genome Atlas. Authors - Yu Zhang View Article
human	IHC	BMC Cancer The expression, immune infiltration, prognosis, and experimental validation of OSBPL family genes in liver cancer Authors - Kunpeng Tian View Article
human	IHC	Biosci Rep Identification of hub genes in colorectal cancer based on weighted gene co-expression network analysis. Authors - Yu Zhang View Article