OSBPL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OSBPL3 Polyclonal antibody (12417-1-AP)

• KD/KO Validated

OSBPL3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12417-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA0704, ORP 3, ORP3, ORP-3, OSBP related protein 3

• 

  WB analysis using 12417-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12417-1-AP (OSBPL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HCT 116 using 12417-1-AP

  WB result of OSBPL3 antibody (12417-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-OSBPL3 transfected HCT 116 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 12417-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12417-1-AP (OSBPL3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12417-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 Antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12417-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 Antibody) at dilution of 1:50 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12417-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12417-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 12417-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 12417-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse bladder using 12417-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat bladder using 12417-1-AP

  Immunohistochemical analysis of paraffin-embedded rat bladder tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 12417-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HCT 116 cells, K-562 cells, HeLa cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12417-1-AP targets OSBPL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3044

  Product name: Recombinant human OSBPL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC017731

  Sequence: MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSA

• Full Name: oxysterol binding protein-like 3
• Calculated Molecular Weight: 887 aa, 101 kDa
• Observed Molecular Weight: 95-110 kDa
• GenBank Accession Number: BC017731
• Gene Symbol: OSBPL3
• Gene ID (NCBI): 26031
• RRID: AB_2156103
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4L5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OSBPL3 (ORP3) is an oxysterol-binding protein-related lipid transfer protein located at ER-plasma membrane contact sites. Its canonical isoform contains 887 amino acids with a theoretical molecular weight of 101.2 kDa. Western blot routinely detects a doublet around 103 kDa and 110 kDa, mainly caused by differential phosphorylation rather than splicing variants. It interacts with R-Ras and VAPA to modulate PI4P transport, actin cytoskeleton dynamics and cell adhesion. Aberrant OSBPL3 expression drives proliferation and metastasis in multiple cancers, acting as a prognostic biomarker and potential therapeutic target. (PMID: 32041906, 34584127)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	BMC Cancer; The expression, immune infiltration, prognosis, and experimental validation of OSBPL family genes in liver cancer; Authors - Kunpeng Tian
human	IHC	Biosci Rep; Identification of hub genes in colorectal cancer based on weighted gene co-expression network analysis and clinical data from The Cancer Genome Atlas.; Authors - Yu Zhang
human	IHC	Biosci Rep; Identification of hub genes in colorectal cancer based on weighted gene co-expression network analysis.; Authors - Yu Zhang
human	WB,IHC	Transl Oncol; OSBPL3 promotes LUAD metastasis and glycolysis through transcriptional upregulation of PLAU via NFE2L2.; Authors - Qingqiong Zhang ; KD Validated