Filter: AllWBIHC

WB analysis using 32158-1-AP (same clone as 32158-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 32158-1-AP (OSBPL6 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32158-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 32158-1-AP (same clone as 32158-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 32158-1-AP (OSBPL6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32158-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 32158-1-AP (same clone as 32158-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 32158-1-AP (OSBPL6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32158-1-PBS in a different storage buffer formulation.

OSBPL6 Polyclonal antibody, PBS Only

OSBPL6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 32158-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

ORP6, ORP-6, OSBP-related protein 6, Oxysterol-binding protein-related protein 6

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

32158-1-PBS targets OSBPL6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag37534 Product name: Recombinant human OSBPL6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 189-308 aa of BC052259 Sequence: RSPRDASFHIFPSTSTAESSPAANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQVPFSATMSPV Predict reactive species
Full Name	oxysterol binding protein-like 6
Calculated Molecular Weight	934 aa, 106 kDa
Observed Molecular Weight	106 kDa
GenBank Accession Number	BC052259
Gene Symbol	OSBPL6
Gene ID (NCBI)	114880
RRID	AB_3742533
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	Q9BZF3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.