OSCAR Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OSCAR Polyclonal antibody, PBS Only (21996-1-PBS)

• 

  WB analysis using 21996-1-AP (same clone as 21996-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21996-1-AP (OSCAR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21996-1-PBS in a different storage buffer formulation.

OSCAR Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21996-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Poly-Ig receptor 3, PIgR-3, PIgR3, Osteoclast-associated receptor, Osteoclast-associated immunoglobulin-like receptor

---

Product Information

21996-1-PBS targets OSCAR in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17366

  Product name: Recombinant human OSCAR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 145-282 aa of BC035023

  Sequence: NVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV

• Full Name: osteoclast associated, immunoglobulin-like receptor
• Calculated Molecular Weight: 282 aa, 31 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC035023
• Gene Symbol: OSCAR
• Gene ID (NCBI): 126014
• RRID: AB_3669383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IYS5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Osteoclast-associated receptor (OSCAR) is an FcRγ-associated receptor that belongs to the leukocyte receptor cluster (LRC). OSCAR is expressed by myeloid cells and is involved in antigen presentation and activation of human dendritic cells(PMID: 15155468; PMID: 15650060). OSCAR is expressed in osteoclast cells and involved in the differentiation of osteoclasts from peripheral blood mononuclear cells (PBMC). The N-glycosylated form of human OSCAR has a molecular weight of approximately 40-45 kDa, while 30 kDa corresponds to its fully non-glycosylated form (PMID: 15155468; 24902903; 27917924)