OSMR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OSMR Polyclonal antibody (10982-1-AP)

• Featured Product
• KD/KO Validated

OSMR Polyclonal Antibody for WB, ELISA

Cat No. 10982-1-AP Copied!

Publications (22)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

IL-31 receptor subunit beta, IL-31R subunit beta, IL-31RB, IL-31R-beta, Interleukin-31 receptor subunit beta

• 

  WB analysis of HeLa using 10982-1-AP

  WB result of OSMR antibody (10982-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-OSMR transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10982-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10982-1-AP (OSMR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10982-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10982-1-AP (OSMR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10982-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10982-1-AP (OSMR antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for OSMR in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, SGC-7901 cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10982-1-AP targets OSMR in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1426

  Product name: Recombinant human OSMR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-342 aa of BC010943

  Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH

• Full Name: oncostatin M receptor
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 110-140 kDa, 150-180 kDa
• GenBank Accession Number: BC010943
• Gene Symbol: OSMR
• Gene ID (NCBI): 9180
• RRID: AB_2156583
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99650
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Oncostatin M (OSM) is a member of interleukin-6 family cytokines that modulates proliferation and differentiation in numerous cells (PMID: 22982441). OSM signals via a receptor complex comprising gp130 and the OSMR (also called OSMRβ) (PMID: 8999038). OSMR is a single-pass membrane protein that belongs to the type I cytokine receptor family. OSMR mRNA is expressed at relatively high levels in all neural cells and fibroblast, epithelial, and various tumor cell lines (PMID: 8999038). It has also been shown that OSMR associates with IL31RA to form the heterodimeric IL31 receptor (PMID: 15184896). OMSR has a calculated molecular weight of 110 kDa, with an apparent molecular weight of 150-180 kDa (PMID: 8999038; 17028186; 39266541; 34644107). A 70 kDa soluble form can be detected by western blot (PMID: 17028186).

Publications

What published studies show

The OSMR Polyclonal antibody (Cat# 10982-1-AP) has 22 citations. Journals include Cell Stem Cell, Cancer Research, Science Advances, Journal of Translational Medicine, Journal of European Academy of Dermatology and Venereology, Neural Regeneration Research, British Journal of Dermatology, Stem Cell Research & Therapy, Cell Reports, Human Reproduction, JCI Insight, CNS Neuroscience & Therapeutics, and others. Research fields span cardiology, oncology (ovarian, glioblastoma, endometrial, breast cancer), neurology (ALS), dermatology (atopic dermatitis, prurigo), immunology, and pulmonary disease.

Automatically generated from the 22 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cell Stem Cell; Oncostatin M is a major mediator of cardiomyocyte dedifferentiation and remodeling.; Authors - Kubin Thomas T
human	IF	Cancer Res; Oncostatin M Receptor-Targeted Antibodies Suppress STAT3 Signaling and Inhibit Ovarian Cancer Growth; Authors - Anjali Geethadevi
mouse,human	IF	Sci Adv; Repression of Osmr and Fgfr1 by miR-1/133a prevents cardiomyocyte dedifferentiation and cell cycle entry in the adult heart.; Authors - Melissa Valussi ; KO Validated
human	WB	J Transl Med; Integrative multi-omics analysis proposes a metabolic classification of gliomas: distinct metabolic states, immune infiltration, and prognosis.; Authors - Qiang Zhu
human	IHC	J Eur Acad Dermatol Venereol; Th2 mRNA gene expression analysis separates Prurigo nodularis into two immune signature groups; Authors - Sonja Ständer
mouse	WB	Neural Regen Res; OSMR is a potential driver of inflammation in amyotrophic lateral sclerosis; Authors - Wenzhi Chen