OSMR Polyclonal antibody

• 

  WB analysis using 10982-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10982-1-AP (OSMR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10982-1-AP

  WB result of OSMR antibody (10982-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-OSMR transfected HeLa cells.

• 

  WB analysis using 10982-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10982-1-AP (OSMR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 10982-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 10982-1-AP (OSMR antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293T using 10982-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 10982-1-AP (OSMR antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

OSMR Polyclonal Antibody for WB, ELISA

Cat No. 10982-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, monkey and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Oncostatin-M-specific receptor subunit beta, Interleukin-31 receptor subunit beta, IL-31R-beta, IL-31RB, IL-31R subunit beta

---

Tested Applications

• Positive WB detected in: HeLa cells, A375 cells, HEK-293T cells, Raji cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 8 publications below
• IHC: See 3 publications below
• IF: See 4 publications below

Product Information

10982-1-AP targets OSMR in WB, IHC, IF, ELISA applications and shows reactivity with human, monkey samples.

• Tested Reactivity: human, monkey
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1426

  Product name: Recombinant human OSMR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-342 aa of BC010943

  Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH

• Full Name: oncostatin M receptor
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC010943
• Gene Symbol: OSMR
• Gene ID (NCBI): 9180
• RRID: AB_2156583
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99650
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Oncostatin M (OSM) is a member of interleukin-6 family cytokines that modulates proliferation and differentiation in numerous cells (PMID: 22982441). OSM signals via a receptor complex comprising gp130 and the OSMR (also refered to as OSMRβ) (PMID: 8999038). OSMR is a single-pass membrane protein that belongs to the type I cytokine receptor family. OSMR mRNA is expressed at relatively high levels in all neural cells and fibroblast, epithelial, and various tumor cell lines (PMID: 8999038). It has also been shown that OSMR associates with IL31RA to form the heterodimeric IL31 receptor (PMID: 15184896). A 70 kDa soluble form can be detected by western blot (PMID: 17028186).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Cell Stem Cell; Oncostatin M is a major mediator of cardiomyocyte dedifferentiation and remodeling.; Authors - Kubin Thomas T
mouse,human	IF	Sci Adv; Repression of Osmr and Fgfr1 by miR-1/133a prevents cardiomyocyte dedifferentiation and cell cycle entry in the adult heart.; Authors - Melissa Valussi ; KO Validated
human	IHC	Cell Rep; Deep spatial proteomics reveals region-specific features of severe COVID-19-related pulmonary injury; Authors - Yiheng Mao
	IF	Br J Dermatol; CD11b+ cells markedly express the itch cytokine interleukin-31 in polymorphic light eruption.; Authors - V Patra
human	WB	Aging (Albany NY); Elevated lymphocyte specific protein 1 expression is involved in the regulation of leukocyte migration and immunosuppressive microenvironment in glioblastoma.; Authors - Jing-Yuan Cao
mouse	WB	Stem Cell Res Ther; Oncostatin M receptor regulates osteoblast differentiation via extracellular signal-regulated kinase/autophagy signaling.; Authors - Jie Zhou ; KD Validated