OSMR Monoclonal antibody

• 

  WB analysis of human brain using 60071-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 60071-1-Ig (OSMR antibody) at dilution of 1:250 incubated at room temperature for 1.5 hours.

OSMR Monoclonal Antibody for ELISA

Cat No. 60071-1-Ig

Clone No.4B11D4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

ELISA

Synonyms

Interleukin-31 receptor subunit beta, IL-31R-beta, IL-31RB, IL-31R subunit beta, IL-31 receptor subunit beta

---

Product Information

60071-1-Ig targets OSMR in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1426

  Product name: Recombinant human OSMR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-342 aa of BC010943

  Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH

• Full Name: oncostatin M receptor
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC010943
• Gene Symbol: OSMR
• Gene ID (NCBI): 9180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q99650
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Oncostatin M (OSM) is a member of interleukin-6 family cytokines that modulates proliferation and differentiation in numerous cells (PMID: 22982441). OSM signals via a receptor complex comprising gp130 and the OSMR (also called OSMRβ) (PMID: 8999038). OSMR is a single-pass membrane protein that belongs to the type I cytokine receptor family. OSMR mRNA is expressed at relatively high levels in all neural cells as well as fibroblast, epithelial and various tumor cell lines (PMID: 8999038). It has also been shown that OSMR associates with IL31RA to form the heterodimeric IL31 receptor (PMID: 15184896).