OSMR Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84555-1-RR (same clone as 84555-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84555-1-RR (OSMR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84555-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 84555-1-RR (same clone as 84555-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 84555-1-RR (OSMR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84555-1-PBS in a different storage buffer formulation.

OSMR Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84555-1-PBS

Clone No.241865A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Interleukin-31 receptor subunit beta, IL-31R-beta, IL-31RB, IL-31R subunit beta, IL-31 receptor subunit beta

---

Product Information

84555-1-PBS targets OSMR in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1426

  Product name: Recombinant human OSMR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-342 aa of BC010943

  Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH

• Full Name: oncostatin M receptor
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 150-180 kDa
• GenBank Accession Number: BC010943
• Gene Symbol: OSMR
• Gene ID (NCBI): 9180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q99650
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Oncostatin M (OSM) is a member of interleukin-6 family cytokines that modulates proliferation and differentiation in numerous cells (PMID: 22982441). OSM signals via a receptor complex comprising gp130 and the OSMR (also referred to as OSMRβ) (PMID: 8999038). OSMR is a single-pass membrane protein that belongs to the type I cytokine receptor family. OSMR mRNA is expressed relatively high in all neural cells and fibroblast, epithelial, and various tumor cell lines (PMID: 8999038). It has also been shown that OSMR associates with IL31RA to form the heterodimeric IL31 receptor (PMID: 15184896). The predicted molecular weight of OSMR is 110 kDa, and bands of 150-180 kDa can also be detected (PMID:8999038 ;34644107; 30226002; 9188471;22056139).