OSMR Recombinant monoclonal antibody, PBS Only

OSMR Uni-rAb® Recombinant Antibody for WB, FC (Intra), Indirect ELISA
Cat No. 84555-2-PBS
Clone No.241865C8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), Indirect ELISA

241865C8, IL-31 receptor subunit beta, IL-31R subunit beta, IL-31RB, IL-31R-beta

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84555-2-PBS targets OSMR in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1426

Product name: Recombinant human OSMR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-342 aa of BC010943

Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH

Predict reactive species
Full Name oncostatin M receptor
Calculated Molecular Weight 110 kDa
Observed Molecular Weight~180 kDa
GenBank Accession NumberBC010943
Gene Symbol OSMR
Gene ID (NCBI) 9180
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ99650
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Oncostatin M (OSM) is a member of interleukin-6 family cytokines that modulates proliferation and differentiation in numerous cells (PMID: 22982441). OSM signals via a receptor complex comprising gp130 and the OSMR (also called OSMRβ) (PMID: 8999038). OSMR is a single-pass membrane protein that belongs to the type I cytokine receptor family. OSMR mRNA is expressed at relatively high levels in all neural cells and fibroblast, epithelial, and various tumor cell lines (PMID: 8999038). It has also been shown that OSMR associates with IL31RA to form the heterodimeric IL31 receptor (PMID: 15184896). OMSR has a calculated molecular weight of 110 kDa, with an apparent molecular weight of 150-180 kDa (PMID: 8999038; 17028186; 39266541; 34644107). A 70 kDa soluble form can be detected by western blot (PMID: 17028186).

Loading...
||
New chat Able
正在加载,请稍候...