OSTN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OSTN Polyclonal antibody, PBS Only (25207-1-PBS)

OSTN Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25207-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

• 

  IHC staining of human skeletal muscle using 25207-1-AP (same clone as 25207-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25207-1-AP (OSTN Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25207-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 25207-1-AP (same clone as 25207-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25207-1-AP (OSTN Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25207-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 25207-1-AP (same clone as 25207-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25207-1-AP (OSTN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25207-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 25207-1-AP (same clone as 25207-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25207-1-AP (OSTN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25207-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for OSTN in ?

Chat with Able

---

Product Information

25207-1-PBS targets OSTN in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19166

  Product name: Recombinant human OSTN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-133 aa of BC128106

  Sequence: VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

• Full Name: osteocrin
• Calculated Molecular Weight: 133 aa, 15 kDa
• GenBank Accession Number: BC128106
• Gene Symbol: OSTN
• Gene ID (NCBI): 344901
• RRID: AB_2879960
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61366
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.