OTOG Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OTOG Polyclonal antibody (33794-1-AP)

• 

  WB analysis using 33794-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33794-1-AP (OTOG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

OTOG Polyclonal Antibody for WB, ELISA

Cat No. 33794-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

OTGN, Otogelin

---

Tested Applications

• Positive WB detected in: Caco-2 cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33794-1-AP targets OTOG in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg5591

  Product name: Recombinant human OTOG protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1634-1796 aa of NM_001277269.2

  Sequence: VRGHGSLPVRTTPPQPSLTASPSSRPVASPGAISRSPTSSGSHKAVLTPAVTKVISRTGVPQPTQAQSASSPSTPLTVAGTAAEQVPVSPLATRSLEIVLSTEKGEAGHSQPMGSPASPQPHPLPSAPPRPAQHTTMATRSPALPPETPAAASLSTATDGLAA

• Full Name: otogelin
• Calculated Molecular Weight: 315 kDa
• Observed Molecular Weight: 314 kDa
• GenBank Accession Number: NM_001277269.2
• Gene Symbol: OTOG
• Gene ID (NCBI): 340990
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZRI0-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OTOG (Otogelin) is a glycoprotein that is highly expressed in the inner ear and is essential for maintaining hearing and balance functions. It belongs to the mucin-like glycoprotein family and is a large extracellular matrix protein with numerous glycosylation sites. This allows it to form gel-like structures that provide structural support during mechanical transduction in the inner ear. Mutations or loss of function in the OTOG gene can lead to severe hereditary deafness and vestibular dysfunction. There are two isoforms of OTOG, with molecular weights of 160 kDa and 314 kDa respectively.