OTOR Polyclonal antibody, PBS Only

• 

  WB analysis of Transfected HEK-293 using 18132-1-AP (same clone as 18132-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 18132-1-AP (OTOR Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18132-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 18132-1-AP (same clone as 18132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18132-1-AP (OTOR antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18132-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 18132-1-AP (same clone as 18132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18132-1-AP (OTOR antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18132-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 18132-1-AP (same clone as 18132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 18132-1-AP (OTOR antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18132-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 18132-1-AP (same clone as 18132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 18132-1-AP (OTOR antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18132-1-PBS in a different storage buffer formulation.

OTOR Polyclonal Antibody for IHC, ELISA

Cat No. 18132-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

FDP, Fibrocyte derived protein, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, MIAL

---

Product Information

18132-1-PBS targets OTOR in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12714

  Product name: Recombinant human OTOR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-128 aa of BC101688

  Sequence: LASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

• Full Name: otoraplin
• Calculated Molecular Weight: 128 aa, 14 kDa
• GenBank Accession Number: BC101688
• Gene Symbol: OTOR
• Gene ID (NCBI): 56914
• RRID: AB_2878505
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRC9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.