OTUD6A Polyclonal antibody

• 

  WB analysis of MCF-7 using 24486-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 24486-1-AP (OTUD6A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 24486-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using OTUD6A antibody (24486-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

OTUD6A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 24486-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF/ICC, IP, CoIP, ELISA

Synonyms

DUBA 2, DUBA2, HSHIN6, OTU domain containing 6A, OTUD6A

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 7 publications below
• IF: See 3 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

24486-1-AP targets OTUD6A in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21639

  Product name: Recombinant human OTUD6A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-146 aa of BC137356

  Sequence: MDDPKSEQQRILRRHQRERQELQAQIRSLKNSVPKTDKTKRKQLLQDVARMEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEEKLAAILGARGLEMKAI

• Full Name: OTU domain containing 6A
• Calculated Molecular Weight: 288 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC137356
• Gene Symbol: OTUD6A
• Gene ID (NCBI): 139562
• RRID: AB_2879567
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L8S5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP,CoIP	Cell Death Differ; Deubiquitinase OTUD6A promotes breast cancer progression by increasing TopBP1 stability and rendering tumor cells resistant to DNA-damaging therapy.; Authors - Yan Zhao
human	IF	Mol Oncol; Deubiquitinase OTUD6A promotes proliferation of cancer cells via regulating Drp1 stability and mitochondrial fission.; Authors - Le Shi ; KD Validated
human	WB	Int J Mol Sci; OTUD6A Is an Aurora Kinase A-Specific Deubiquitinase.; Authors - Hyo Jin Kim
human	WB	Commun Biol; OTUD6A promotes prostate tumorigenesis via deubiquitinating Brg1 and AR.; Authors - Xuhong Fu
human	WB	FEBS Lett; OTUD6A orchestrates complex modulation of TEAD4-mediated transcriptional programs; Authors - Hyo Jin Kim
		Int J Oncol; Ubiquitin-specific peptidase 5 and ovarian tumor deubiquitinase 6A are differentially expressed in p53+/+ and p53-/- HCT116 cells.; Authors - Soo-Yeon Kim