OTUD6B Polyclonal antibody

• 

  WB analysis using 25430-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25430-1-AP (OTUD6B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 25430-1-AP

  WB result of OTUD6B antibody (25430-1-AP; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-OTUD6B transfected HeLa cells.

• 

  WB analysis of HEK-293 using 25430-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25430-1-AP (OTUD6B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 25430-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25430-1-AP (OTUD6B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 25430-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25430-1-AP (OTUD6B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 25430-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 25430-1-AP (OTUD6B antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-3 using 25430-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 25430-1-AP (OTUD6B antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

OTUD6B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25430-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CGI 77, CGI-77, Deubiquitinase OTUD6B, DUBA 5, DUBA5

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells, PC-3 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

25430-1-AP targets OTUD6B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22044

  Product name: Recombinant human OTUD6B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC029760

  Sequence: MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGH

• Full Name: OTU domain containing 6B
• Calculated Molecular Weight: 293 aa, 34 kDa
• Observed Molecular Weight: 34-40 kDa
• GenBank Accession Number: BC029760
• Gene Symbol: OTUD6B
• Gene ID (NCBI): 51633
• RRID: AB_2880075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N6M0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cell Mol Life Sci; Otud6b induces pulmonary arterial hypertension by mediating the Calpain-1/HIF-1α signaling pathway; Authors - Yu Liu ; KD Validated
human	IHC,IF	Cell Biol Int; OTUD6B promotes cholangiocarcinoma growth by regulating STAT3 phosphorylation through deubiquitination of PTK2; Authors - Guoqiang Xing ; KD Validated
human	WB	EMBO Rep; OTUD6B regulates KIFC1-dependent centrosome clustering and breast cancer cell survival; Authors - Valeria E Marotta

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Dorota (Verified Customer) (04-11-2019)

Antibody works perfectly for western blotting, however I could not optimise it for immunofluorescence. I tried series of dilutions and couple of different blocking/fixing methods, but there was no difference between knockdown and control conditions in any of them.

• Applications: Western Blot, Immunofluorescence,
• Primary Antibody Dilution: 1:500-1:5000
• Cell Tissue Type: BT549

OTUD6B Antibody Western Blot,Immunofluorescence, validation (1:500-1:5000 dilution) in BT549 (Cat no:25430-1-AP)