OTUD6B Monoclonal antibody, PBS Only (Capture)

OTUD6B Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 68450-1-PBS
Clone No.1D1G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

1D1G1, CGI 77, CGI-77, Deubiquitinase OTUD6B, DUBA 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68450-1-PBS targets OTUD6B as part of a matched antibody pair:

MP50962-1: 68450-1-PBS capture and 68450-2-PBS detection (validated in Cytometric bead array)

MP50962-2: 68450-1-PBS capture and 68450-3-PBS detection (validated in Cytometric bead array)

MP50962-3: 68450-1-PBS capture and 68450-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33607

Product name: Recombinant human OTUD6B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-157 aa of BC029760

Sequence: MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGH

Predict reactive species
Full Name OTU domain containing 6B
Calculated Molecular Weight 293 aa, 34 kDa
Observed Molecular Weight 34-40 kDa
GenBank Accession NumberBC029760
Gene Symbol OTUD6B
Gene ID (NCBI) 51633
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8N6M0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

OTUD6B, also known as DUBA5, belongs to a DUB subfamily characterized by an ovarian tumor domain (OTU). It's a functional deubiquitinating enzyme, a class of protease that specifically cleaves ubiquitin linkages. OTUD6B function may be connected to growth and proliferation. It has been reported that OTUD6B could significantly suppress HCC cells migration and metastasis. The calculated molecular weight of OTUD6B is 34 kDa, 68450-1-Ig can detect the band around 34 kDa.(PMID:32323143)

Loading...
||
New chat

Able

正在加载,请稍候...