OXNAD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OXNAD1 Polyclonal antibody, PBS Only (23907-1-PBS)

• 

  WB analysis using 23907-1-AP (same clone as 23907-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23907-1-AP (OXNAD1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23907-1-PBS in a different storage buffer formulation.

OXNAD1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23907-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:1.-.-.-, Oxidoreductase NAD-binding domain-containing protein 1

---

Product Information

23907-1-PBS targets OXNAD1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20998

  Product name: Recombinant human OXNAD1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-312 aa of BC008322

  Sequence: MACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW

• Full Name: oxidoreductase NAD-binding domain containing 1
• Calculated Molecular Weight: 312 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC008322
• Gene Symbol: OXNAD1
• Gene ID (NCBI): 92106
• RRID: AB_3742096
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96HP4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.