OXSM Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OXSM Polyclonal antibody, PBS Only (16642-1-PBS)

• 

  WB analysis of human heart using 16642-1-AP (same clone as 16642-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 16642-1-AP (OXSM antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16642-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 16642-1-AP (same clone as 16642-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 16642-1-AP (OXSM antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16642-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 16642-1-AP (same clone as 16642-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 16642-1-AP (OXSM Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 16642-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 16642-1-AP (same clone as 16642-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 16642-1-AP (OXSM Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 16642-1-PBS in a different storage buffer formulation.

OXSM Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16642-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

16642-1-PBS targets OXSM in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10004

  Product name: Recombinant human OXSM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 160-459 aa of BC008202

  Sequence: VSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSTNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYINAHATSTPLGDAAENKAIKHLFKDHAYALAVSSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL

• Full Name: 3-oxoacyl-ACP synthase, mitochondrial
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC008202
• Gene Symbol: OXSM
• Gene ID (NCBI): 54995
• RRID: AB_2267657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWU1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.