Neurophysin 1 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84791-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 84791-1-PBS against Human OXT was performed. The affinity constant is 0.508 nM.

Neurophysin 1 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84791-1-PBS

Clone No.242251B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

OXT, Ocytocin Neurophysin 1, Oxytocin, Oxytocin neurophysin 1, Oxytocin-neurophysin 1

---

Product Information

84791-1-PBS targets Neurophysin 1 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2237

  Product name: Recombinant Human OXT protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 32-125 aa of BC101841

  Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

• Full Name: oxytocin, prepropeptide
• Calculated Molecular Weight: 125 aa, 13 kDa
• GenBank Accession Number: BC101841
• Gene Symbol: OXT
• Gene ID (NCBI): 5020
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01178
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.