Occludin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Occludin Recombinant monoclonal antibody, PBS Only (80545-1-PBS)

Occludin Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Cat No. 80545-1-PBS Copied!

Clone No. 8B2

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Synonyms

OCLN

• 

  WB analysis using 80545-1-RR (same clone as 80545-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 80545-1-RR (Occludin antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 80545-1-RR (same clone as 80545-1-PBS)

  HaCaT cells were subjected to SDS PAGE followed by western blot with 80545-1-RR (Occludin antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig colon using 80545-1-RR (same clone as 80545-1-PBS)

  pig colon tissue were subjected to SDS PAGE followed by western blot with 80545-1-RR (Occludin antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse colon using 80545-1-RR (same clone as 80545-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 80545-1-RR (Occludin antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HUVEC using 80545-1-RR (same clone as 80545-1-PBS)

  IP result of anti-Occludin (IP:80545-1-RR, 4ug; Detection:80545-1-RR 1:15000) with HUVEC cells lysate 1410 ug. This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 80545-1-RR (same clone as 80545-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 80545-1-RR (Occludin antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 80545-1-RR (same clone as 80545-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 80545-1-RR (Occludin antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse colon using 80545-1-RR (same clone as 80545-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Occludin antibody (80545-1-RR, Clone: 8B2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse colon using 80545-1-RR (same clone as 80545-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Occludin antibody (80545-1-RR, Clone: 8B2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat colon using 80545-1-RR (same clone as 80545-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat colon tissue using Occludin antibody (80545-1-RR, Clone: 8B2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat colon using 80545-1-RR (same clone as 80545-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat colon tissue using Occludin antibody (80545-1-RR, Clone: 8B2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 80545-1-RR (same clone as 80545-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Occludin antibody (80545-1-RR, Clone: 8B2 ) at dilution of 1:500 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L)(SA00013-1); Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red) and CoraLite594-conjugated Goat Anti-Mouse IgG(H+L)(SA00013-3). This data was developed using the same antibody clone with 80545-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 80545-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80545-1-RR against Human Occludin were performed. The affinity constant is 26.5 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Occludin in ?

Chat with Able

---

Product Information

80545-1-PBS targets Occludin in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26173

  Product name: Recombinant human Occludin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 360-522 aa of BC029886

  Sequence: VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

• Full Name: occludin
• Calculated Molecular Weight: 522 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC029886
• Gene Symbol: Occludin
• Gene ID (NCBI): 4950
• RRID: AB_2918901
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16625
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini, and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels. The monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).

Publications

What published studies show

The Occludin Recombinant Monoclonal Antibody (8B2), catalog number 80545-1-PBS, has a total of 6 citations. The indexed citation appears in Frontiers in Veterinary Science (2025), a journal with an impact factor of 3.1. The research focuses on the effects of traditional Chinese medicine monomers on mechanical barrier damage and inflammatory responses in IPEC-J2 intestinal epithelial cells, placing it within the fields of veterinary science, intestinal barrier biology, and immunology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Front Vet Sci; Effect of four traditional Chinese medicine monomers on mechanical barrier damage and inflammation response of IPEC-J2 cells caused by soybean 7S globulin; Authors - Youtian Deng