Mouse Olr1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP02348-1

  Serum of sixteen mice was measured. The OLR1/LOX1 concentration of detected samples was determined to be 5,082.6 pg/mL with a range of 2,635.3-6,814.9 pg/mL.

• 

  Sandwich ELISA sample test of MP02348-1

  Mouse lung, cut into 1-2 mm pieces, was cultured in RPMI supplemented with 10% fetal bovine serum. An aliquot of the cell culture supernatant was removed, assayed for mouse OLR1/LOX1 and measured 356.4 pg/mL.

• 

  Sandwich ELISA standard curve of MP02348-1

  Sandwich ELISA standard curve of MP02348-1, Mouse OLR1/LOX1 Recombinant Matched Antibody Pair - PBS only. 86230-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2473. 86230-1-PBS was HRP conjugated as the detection antibody. Range: 31.3-2000 pg/mL.

• 

  Cytometric bead array sample test of MP02348-1

  The mean OLR1/LOX1 concentration was determined to be 5.5 ng/mL in mouse serum.

• 

  Cytometric bead array standard curve of MP02348-1

  Cytometric bead array standard curve of MP02348-1, MOUSE OLR1/LOX1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86230-2-PBS. Detection antibody: 86230-1-PBS. Standard: Eg2473. Range: 0.156-20 ng/mL.

Olr1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86230-1-PBS

Clone No.250111H3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

Lectin-like oxidized LDL receptor 1, Lectin-like oxLDL receptor 1, Lectin-type oxidized LDL receptor 1, Lox1, LOX-1

---

Product Information

86230-1-PBS targets Olr1 as part of a matched antibody pair:

MP02348-1: 86230-2-PBS capture and 86230-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2473

  Product name: Recombinant Mouse OLR1/LOX1 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 60-363 aa of NM_138648.2

  Sequence: RQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

• Full Name: oxidized low density lipoprotein (lectin-like) receptor 1
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: NM_138648.2
• Gene Symbol: Olr1
• Gene ID (NCBI): 108078
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9EQ09
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.