CDKN2A/P16-INK4A Monoclonal antibody

CDKN2A/P16-INK4A Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60626-1-Ig
Clone No.1C9D3

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

p16, p16 INK4, P16 INK4A, p16-INK4, p16INK4A

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSiHa cells, HeLa cells, HEK-293 cells, TF-1 cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:2500-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

60626-1-Ig targets CDKN2A/P16-INK4A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1328

Product name: Recombinant human P16-INK4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 52-156 aa of BC021998

Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predict reactive species
Full Name cyclin-dependent kinase inhibitor 2A
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC021998
Gene Symbol CDKN2A
Gene ID (NCBI) 1029
RRIDAB_3670270
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

P16-INK4A is also named as CDKN2A, MLM, Tumor suppressor ARF, Alternative reading frame. The tumor suppressor protein p16Ink4a (encoded from the CDKN2A locus) is often transcriptionally activated in cells undergoing senescence and is one of the main regulators of this program, and it is upregulated in multiple tissues during aging (PMID:17055429). p16-Ink4a is the principal member of the Ink4 family of CDK inhibitors. p16-Ink4a contributes to the regulation of cell cycle progression by inhibiting the S phase. p16Ink4a binds to CDK4/6, inhibiting cyclin D-CDK4/6 complex formation and CDK4/6-mediated phosphorylation of Rb family members. Expression of p16-Ink4a maintains the Rb family members in a hypophosphorylated state, which promotes binding to E2F1 and leads to G1 cell cycle arrest (PMID: 21297668).

Protocols

Product Specific Protocols
WB protocol for CDKN2A/P16-INK4A antibody 60626-1-IgDownload protocol
IHC protocol for CDKN2A/P16-INK4A antibody 60626-1-IgDownload protocol
IF protocol for CDKN2A/P16-INK4A antibody 60626-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB

Nat Aging

Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer

Authors - Yifei Cheng
mouseWB

Hum Vaccin Immunother

Nanovaccine loaded with seno-antigen target senescent cells to improve metabolic disorders of adipose tissue and cardiac dysfunction

Authors - Kexin Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marisa (Verified Customer) (07-31-2025)

We used the p16 antibody from Proteintech for immunofluorescence on mouse brain, followed by confocal microscopy. The antibody produced a strong, specific signal and Minimal background and high signal-to-noise ratio made it easy to interpret.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/250
  • Cell Tissue Type: Brain
CDKN2A/P16-INK4A Antibody Immunofluorescence validation (1/250 dilution) in Brain (Cat no:60626-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...