P21 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• P21 Polyclonal antibody (25860-1-AP)

P21 Polyclonal Antibody for ELISA

Cat No. 25860-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

CAP20, CDK interacting protein 1, CDKN1, CDKN1A, CIP1, MDA 6, MDA6, P21, p21CIP1, PIC1, SDI1, WAF1

• 

Able AI

What's the best dilution for P21 in ?

Chat with Able

---

Product Information

25860-1-AP targets P21 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23087

  Product name: Recombinant human P21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 54-164 aa of BC000312

  Sequence: VTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP

• Full Name: cyclin-dependent kinase inhibitor 1A (p21, Cip1)
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC000312
• Gene Symbol: p21
• Gene ID (NCBI): 1026
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P38936
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The P21 polyclonal antibody (Cat# 25860-1-AP) has 6 citations published in 2025 across journals including Redox Biology, Journal of Medicinal Chemistry, International Immunopharmacology, Bioorganic Chemistry, and Biochemical and Biophysical Research Communications. The research fields span mitophagy in COPD and osteoarthritis, antitumor immunotherapy, post-stroke atherosclerosis, pancreatic cancer mechanisms, and trophoblast cell cycle regulation.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Redox Biol; Arylsulfatase K attenuates airway epithelial cell senescence in COPD by regulating parkin-mediated mitophagy; Authors - Ruonan Yang
		J Med Chem; A Dual-Specificity d-Peptide Antagonist of MDM2 and MDMX for Antitumor Immunotherapy; Authors - Chongbing Liao
		Int Immunopharmacol; Neuronal pentraxin 1 accelerates post-stroke atherosclerosis by inducing endothelial cell senescence; Authors - Yu Wu
rat	WB	Int Immunopharmacol; Ginsenoside Rh1 attenuates chondrocyte senescence and osteoarthritis via AMPK/PINK1/Parkin-mediated mitophagy; Authors - Haitao Chen
human	WB	Bioorg Chem; Mechanism of sulforaphane in treatment of pancreatic cancer cell based on network pharmacology and in vitro experiments; Authors - Ziyi Ren
human	WB	Biochem Biophys Res Commun; Shp2 regulates the trophoblast cell cycle progression through p53-p21 pathway modulation; Authors - Ming-Hui Meng