P21 Polyclonal antibody

• 

P21 Polyclonal Antibody for ELISA

Cat No. 25860-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

CAP20, CDK interacting protein 1, CDKN1, CDKN1A, CIP1, MDA 6, MDA6, P21, p21CIP1, PIC1, SDI1, WAF1

---

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

25860-1-AP targets P21 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23087

  Product name: Recombinant human P21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 54-164 aa of BC000312

  Sequence: VTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP

• Full Name: cyclin-dependent kinase inhibitor 1A (p21, Cip1)
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC000312
• Gene Symbol: p21
• Gene ID (NCBI): 1026
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P38936
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Redox Biol; Arylsulfatase K attenuates airway epithelial cell senescence in COPD by regulating parkin-mediated mitophagy; Authors - Ruonan Yang
rat	WB	Int Immunopharmacol; Ginsenoside Rh1 attenuates chondrocyte senescence and osteoarthritis via AMPK/PINK1/Parkin-mediated mitophagy; Authors - Haitao Chen
human	WB	Bioorg Chem; Mechanism of sulforaphane in treatment of pancreatic cancer cell based on network pharmacology and in vitro experiments; Authors - Ziyi Ren
human	WB	Biochem Biophys Res Commun; Shp2 regulates the trophoblast cell cycle progression through p53-p21 pathway modulation; Authors - Ming-Hui Meng