P2RX5 Monoclonal antibody, PBS Only

• 

  WB analysis using 66430-1-Ig (same clone as 66430-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66430-1-Ig (P2RX5 Antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66430-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 66430-1-Ig (same clone as 66430-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66430-1-Ig (P2RX5 Antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66430-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brown adipose using 66430-1-Ig (same clone as 66430-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brown adipose tissue using P2RX5 antibody (66430-1-Ig, Clone: 2A2A6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66430-1-PBS in a different storage buffer formulation.

P2RX5 Monoclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 66430-1-PBS

Clone No.2A2A6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IF-P, Indirect ELISA

Synonyms

ATP receptor, P2RX5, P2X purinoceptor 5, P2X5, P2X5R, Purinergic receptor

---

Product Information

66430-1-PBS targets P2RX5 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5297

  Product name: Recombinant human P2RX5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 52-422 aa of BC039015

  Sequence: KKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST

• Full Name: purinergic receptor P2X, ligand-gated ion channel, 5
• Calculated Molecular Weight: 422 aa, 47 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC039015
• Gene Symbol: P2RX5
• Gene ID (NCBI): 5026
• RRID: AB_2881801
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q93086
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.