P2RY11 Polyclonal antibody

• 

  WB analysis using 20191-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20191-1-AP (P2RY11 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

P2RY11 Polyclonal Antibody for WB, ELISA

Cat No. 20191-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

P2RY11, P2Y purinoceptor 11, P2Y11

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20191-1-AP targets P2RY11 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14106

  Product name: Recombinant human P2RY11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 104-213 aa of BC009877

  Sequence: HIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ

• Full Name: purinergic receptor P2Y, G-protein coupled, 11
• Calculated Molecular Weight: 374 aa, 40 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC009877
• Gene Symbol: P2RY11
• Gene ID (NCBI): 5032
• RRID: AB_3669328
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96G91
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs). P2Y purinoceptor 11 (P2RY11) is a receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. It is not activated by UTP or UDP (PMID: 9405388). Expression of P2RY11 has been detected in immune cells including dendritic cells, macrophages and non‐immune cells including cancer cells (PMID: 33463722). It is involved in immune regulation (PMID: 27246167). No murine P2ry11 has been identified.