P2RY6 Polyclonal antibody

• 

  WB analysis of A549 using 11300-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 11300-1-AP (P2RY6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

P2RY6 Polyclonal Antibody for WB, ELISA

Cat No. 11300-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

P2RY6, P2Y purinoceptor 6, P2Y6

---

Tested Applications

• Positive WB detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

11300-1-AP targets P2RY6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1820

  Product name: Recombinant human P2RY6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-328 aa of BC009391

  Sequence: MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR

• Full Name: pyrimidinergic receptor P2Y, G-protein coupled, 6
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC009391
• Gene Symbol: P2RY6
• Gene ID (NCBI): 5031
• RRID: AB_2283156
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15077
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs). P2RY6 is responsive to UDP, partially responsive to UTP and ADP, and not responsive to ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. (PMID: 8670200; 21724990)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Radiat Res; Involvement of P2Y6 Receptor in p38 MAPK-Mediated COX-2 Expression in Response to UVB Irradiation of Human Keratinocytes.; Authors - Takai Erina E
human	WB	Radiat Res; Involvement of P2Y6 receptor in p38 MAPK-mediated COX-2 expression in response to UVB irradiation of human keratinocytes.; Authors - Erina Takai