PACSIN1 Polyclonal antibody

PACSIN1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 13219-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Syndapin-1, SDPI, KIAA1379

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse cerebellum tissue, mouse brain tissue
Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13219-1-AP targets PACSIN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4102

Product name: Recombinant human PACSIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 243-389 aa of BC040228

Sequence: VFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVR

Predict reactive species
Full Name protein kinase C and casein kinase substrate in neurons 1
Calculated Molecular Weight 444 aa, 51 kDa
Observed Molecular Weight 48-51 kDa
GenBank Accession NumberBC040228
Gene Symbol PACSIN1
Gene ID (NCBI) 29993
RRIDAB_10637851
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BY11
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PACSIN1 (also known as syndapin-1) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family. In mammals, the PACSIN family is comprised of three members, PACSIN1, PACSIN2, and PACSIN3 (PMID: 34990060). PACSIN1 is expressed mainly in neurons, whereas PACSIN2 is ubiquitously expressed in all tissues, and PACSIN3 is expressed mainly in skeletal muscle and the heart (PMID: 23668323). All of these three members contain an N-terminal F-BAR domain and a C-terminal SH3 domain. PACSIN1 plays a role in endocytosis and endosomal recycling. Meanwhile, it has a role in actin remodeling and microtubule nucleation and also plays a particular role in membrane shaping and reconstruction (PMID: 23035120; 34422904). PACSIN1 is involved in neuromorphogenesis and the regulation of the nervous system, and the inappropriate expression of PACSIN1 has been associated with some neurological diseases, including schizophrenia, Alzheimer's disease, and Huntington's disease (PMID: 34990060).

Protocols

Product Specific Protocols
IF protocol for PACSIN1 antibody 13219-1-APDownload protocol
IHC protocol for PACSIN1 antibody 13219-1-APDownload protocol
WB protocol for PACSIN1 antibody 13219-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Front Mol Biosci

Decreased Expression of PACSIN1 in Brain Glioma Samples Predicts Poor Prognosis.

Authors - Zhou Zimu
mouseWB

Aging (Albany NY)

GATA2 downregulation contributes to pro-inflammatory phenotype and defective phagocytosis of pulmonary macrophages in chronic obstructive pulmonary disease

Authors - Shaoran Shen
Loading...
||
New chat Able
正在加载,请稍候...