• Featured Product
  • KD/KO Validated

PACSIN2 Polyclonal antibody

PACSIN2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10518-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Syndapin-II, Syndapin-2, SdpII, Protein kinase C and casein kinase substrate in neurons protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, mouse heart tissue, mouse lung tissue, NIH/3T3 cells, HepG2 cells
Positive IP detected inNIH/3T3 cells
Positive IHC detected inhuman breast cancer tissue, human skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10518-2-AP targets PACSIN2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0809

Product name: Recombinant human PACSIN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 180-486 aa of BC008037

Sequence: PSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ

Predict reactive species
Full Name protein kinase C and casein kinase substrate in neurons 2
Calculated Molecular Weight 56 kDa
Observed Molecular Weight 60-65 kDa
GenBank Accession NumberBC008037
Gene Symbol PACSIN2
Gene ID (NCBI) 11252
RRIDAB_2161854
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UNF0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peripheral membrane proteins of the Bin/amphiphysin/Rvs (BAR) and Fer-CIP4 homology-BAR (F-BAR) family participate in cellular membrane trafficking (PMID: 19549836). PACSIN2 (also known as syndapin-2) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family, which are membrane-binding proteins characterized by an amino-terminal F-BAR domain. PACSIN2 plays a role in intracellular vesicle-mediated transport. It is involved in the endocytosis of cell-surface receptors like the EGF receptor, contributing to its internalization (PMID: 23129763). PACSIN2 also has a role in caveolae membrane sculpting (PMID: 21610094).

Protocols

Product Specific Protocols
IF protocol for PACSIN2 antibody 10518-2-APDownload protocol
IHC protocol for PACSIN2 antibody 10518-2-APDownload protocol
IP protocol for PACSIN2 antibody 10518-2-APDownload protocol
WB protocol for PACSIN2 antibody 10518-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Mol Biol Cell

Cooperation of MICAL-L1, syndapin2, and phosphatidic acid in tubular recycling endosome biogenesis.

Authors - Giridharan Sai Srinivas Panapakkam SS
  • KD Validated
humanWB

PLoS One

Role of Phosphatidylinositol 4,5-Bisphosphate in Regulating EHD2 Plasma Membrane Localization.

Authors - Simone Laura C LC
  • KD Validated
humanWB,IF

J Bacteriol

Application of a C. trachomatis expression system to identify C. pneumoniae proteins translocated into host cells.

Authors - Izumi Yanatori
humanWB

Cell Rep

Endogenous Cyclin D1 Promotes the Rate of Onset and Magnitude of Mitogenic Signaling via Akt1 Ser473 Phosphorylation.

Authors - Ke Chen
mouseWB,IF

Nat Commun

The molecular organization of differentially curved caveolae indicates bendable structural units at the plasma membrane

Authors - Claudia Matthaeus
human,mouse,zebrafishWB,IF

Nat Commun

Investigation of F-BAR domain PACSIN proteins uncovers membrane tubulation function in cilia assembly and transport.

Authors - Christine Insinna
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Herve (Verified Customer) (11-13-2019)

This antibody recognizes a 55-kDa band that is present in both Pacsin2 WT and KO platelet lysates. PACSIN2 runs normally at 65 kDa in human and mouse platelet lysates and is absent in mouse Pacsin2 KO samples.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Platelets
Loading...
||
New chat Able
正在加载,请稍候...